DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vsx2 and lhx4

DIOPT Version :9

Sequence 1:NP_001284897.1 Gene:Vsx2 / 31469 FlyBaseID:FBgn0263512 Length:645 Species:Drosophila melanogaster
Sequence 2:NP_001116445.1 Gene:lhx4 / 571943 ZFINID:ZDB-GENE-060728-1 Length:391 Species:Danio rerio


Alignment Length:242 Identity:66/242 - (27%)
Similarity:93/242 - (38%) Gaps:60/242 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   231 RHSRTIFTSYQLEKLEEAFKEAHYPDVYAREMLSLKTELPEDRIQVWFQNRRAKWRKTEKVWGGS 295
            :..||..|:.|||.|:.|:|.:..|..:.||.||.:|.|....:||||||||||.::.:|..|  
Zfish   161 KRPRTTITAKQLETLKSAYKNSPKPARHVREQLSSETGLDMRVVQVWFQNRRAKEKRLKKDAG-- 223

  Fly   296 TIMAEYGLYGAMVRHSLPLPDTILKSAKDNDAVAPWLLGMEQKCMHRKSIEAQSALKDDSGVSDH 360
                         ||..   ....||.|.|...:             |:.:..||  ||:|:||.
Zfish   224 -------------RHRW---GQFYKSVKRNRGSS-------------KTEKESSA--DDAGLSDS 257

  Fly   361 E-----DSAGSKSAHSEDL-----SRSRCHALSSS---------TESLNVVSP-----APSSCPT 401
            |     |...|...|:..|     ..|..:.|:.|         ...|...||     :|||. |
Zfish   258 ELSFRDDQILSDLGHANGLYGSVGDVSNGNMLNGSFSLDGGGQPYHDLRAGSPYGLPQSPSSI-T 321

  Fly   402 SASTSAPPTSTSGYA--GAASSAATTPTGASTTNSSSSPHIELGSPS 446
            |.....|..:..|::  |....|.....|.:....:..|..:|.:.|
Zfish   322 SLPGHTPLLNNLGFSMDGLMGQAGQPSVGQALRAMAGGPTSDLSTGS 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vsx2NP_001284897.1 Homeobox 233..286 CDD:278475 26/52 (50%)
OAR 556..570 CDD:281777
lhx4NP_001116445.1 LIM1_Lhx4 33..84 CDD:188852
LIM2_Lhx3_Lhx4 92..147 CDD:188762
Homeobox 163..216 CDD:278475 26/52 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1174754at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.