DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vsx2 and gsb-n

DIOPT Version :9

Sequence 1:NP_001284897.1 Gene:Vsx2 / 31469 FlyBaseID:FBgn0263512 Length:645 Species:Drosophila melanogaster
Sequence 2:NP_523862.1 Gene:gsb-n / 38004 FlyBaseID:FBgn0001147 Length:449 Species:Drosophila melanogaster


Alignment Length:308 Identity:90/308 - (29%)
Similarity:124/308 - (40%) Gaps:71/308 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   207 KDFGMESLNGFGVGPNSK----------KKKKKRRHSRTIFTSYQLEKLEEAFKEAHYPDVYARE 261
            ||:   ::||...|.:|.          ..|:|:|.|||.||:.|||.||.||....|||||.||
  Fly   152 KDY---TINGILGGRDSDISDTESEPGIPLKRKQRRSRTTFTAEQLEALERAFSRTQYPDVYTRE 213

  Fly   262 MLSLKTELPEDRIQVWFQNRRAKWRK---------TEKVWGGSTIMAEYGLYGA----------- 306
            .|:..|.|.|.||||||.||||:.||         :....|.|.:....||.||           
  Fly   214 ELAQTTALTEARIQVWFSNRRARLRKHSGGSNSGLSPMNSGSSNVGVGVGLSGATAPLGYGPLGV 278

  Fly   307 --MVRHSLPLPDTILKSAKDNDAV-----APWLLGMEQKCMHRKSIEAQSALKDDS--GVSDHED 362
              |..:| |.|.|....|..||.|     ||        ..|..:..|.:|....:  |..|...
  Fly   279 GSMAGYS-PAPGTTATGAGMNDGVHHAAHAP--------SSHHSAATAAAAAHHHTQMGGYDLVQ 334

  Fly   363 SA---------------GSKSAHSEDLSRSRCHALSSST-ESLNVVSPAPSSCPTSASTSAPPT- 410
            ||               ||::.:.:|.|:......|..| :|::.:||:.......:...||.. 
  Fly   335 SAAQHGFPGGFAQPGHFGSQNYYHQDYSKLTIDDFSKLTADSVSKISPSLHLSDNYSKLEAPSNW 399

  Fly   411 STSGYAGAASSAATTPTGASTTNSSSSPHIELGSPSPQQQQHLQLQQQ 458
            |.:.|..||:..|..........::::.|   |:|:......|..|.|
  Fly   400 SQAAYHAAANYNAHVAQHQLNDYAAAAAH---GNPASAYSHPLPTQGQ 444

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vsx2NP_001284897.1 Homeobox 233..286 CDD:278475 33/52 (63%)
OAR 556..570 CDD:281777
gsb-nNP_523862.1 PAX 20..141 CDD:278709
Homeobox 185..238 CDD:278475 33/52 (63%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450956
Domainoid 1 1.000 55 1.000 Domainoid score I4097
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.