DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vsx2 and Alx1

DIOPT Version :9

Sequence 1:NP_001284897.1 Gene:Vsx2 / 31469 FlyBaseID:FBgn0263512 Length:645 Species:Drosophila melanogaster
Sequence 2:NP_037053.1 Gene:Alx1 / 25401 RGDID:2273 Length:326 Species:Rattus norvegicus


Alignment Length:248 Identity:75/248 - (30%)
Similarity:98/248 - (39%) Gaps:75/248 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   164 PPPPMQHH---------HPHHPHHPLLHAQGFPQLKSFAAGAGTCLPGSLAPKDFGM---ESLNG 216
            |.|..:||         .....::.:...:|.|...........|....::|.. ||   ..|:.
  Rat    55 PLPRAEHHVRLDRTSPCQDSSVNYGITKVEGQPLHTELNRAMDGCNNLRMSPVK-GMPEKSELDE 118

  Fly   217 FGVGPNSKKKKKKRRHSRTIFTSYQLEKLEEAFKEAHYPDVYAREMLSLKTELPEDRIQVWFQNR 281
            .|...:|.....|:|..||.|||.|||:||:.|::.||||||.||.|:|:|||.|.|:|||||||
  Rat   119 LGDKCDSNVSSSKKRRHRTTFTSLQLEELEKVFQKTHYPDVYVREQLALRTELTEARVQVWFQNR 183

  Fly   282 RAKWRKTEK--------------------------------VWGGSTIMAEYGLYGAMVRHSLPL 314
            ||||||.|:                                :|.|:|       .|..|..|..|
  Rat   184 RAKWRKRERYGQIQQAKSHFAATYDISVLPRTDSYPQIQNNLWAGNT-------SGGSVVTSCML 241

  Fly   315 PDTILKSAKDNDAVAPWLLGMEQKCMHRKSIEAQSALKDDS--GVSDHEDSAG 365
            |         .||         ..||...|   .|...|.|  |.|:|::..|
  Rat   242 P---------RDA---------SSCMTPYS---HSPRTDSSYTGFSNHQNQFG 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vsx2NP_001284897.1 Homeobox 233..286 CDD:278475 36/52 (69%)
OAR 556..570 CDD:281777
Alx1NP_037053.1 Homeobox 135..188 CDD:278475 36/52 (69%)
Transactivation domain. /evidence=ECO:0000269|PubMed:12390248 192..326 20/110 (18%)
OAR 302..319 CDD:281777
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 306..319
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D454642at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.880

Return to query results.
Submit another query.