DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vsx2 and Drgx

DIOPT Version :9

Sequence 1:NP_001284897.1 Gene:Vsx2 / 31469 FlyBaseID:FBgn0263512 Length:645 Species:Drosophila melanogaster
Sequence 2:NP_665710.2 Gene:Drgx / 252880 RGDID:628616 Length:263 Species:Rattus norvegicus


Alignment Length:270 Identity:82/270 - (30%)
Similarity:116/270 - (42%) Gaps:81/270 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   187 PQLKSFAAGAGTCLPGSLAPKDFGMESLNGFGVGPNSKKKKKKRRHSRTIFTSYQLEKLEEAFKE 251
            |||:      ||...|:.:..||.    :||        .::|:|.:||.||..|||.||..|.:
  Rat     8 PQLE------GTAPFGNHSTGDFD----DGF--------LRRKQRRNRTTFTLQQLEALEAVFAQ 54

  Fly   252 AHYPDVYAREMLSLKTELPEDRIQVWFQNRRAKWRKTEKVWGGS--------------------- 295
            .|||||:.||.|::|..|.|.|:|||||||||||||||:  |.|                     
  Rat    55 THYPDVFTREELAMKINLTEARVQVWFQNRRAKWRKTER--GASDQEPGAKEPMAEVTPPPVRNI 117

  Fly   296 --------------TIMAEYGLYGAMVRHSLP-----LPDTILKSAKDNDAVAPWLLGMEQKCMH 341
                          .:.|:..| |..|..:.|     ||.|:|.:|....|::           |
  Rat   118 NSPPPGDQARGKKEALEAQQSL-GRTVGPAGPFFPSCLPGTLLNTATYAQALS-----------H 170

  Fly   342 RKSIE----AQSALKDDSGVSDHEDSAGSKSAHSEDLSRSRCHALSSS---TESLNVVSPAPSSC 399
            ..|::    ....:.|..|:| ...:.|.:|..:..::..|..|...|   .:|.|:: |:.||.
  Rat   171 VASLKGGPLCSCCVPDPMGLS-FLPTYGCQSNRTASVAALRMKAREHSEAVLQSANLL-PSTSSS 233

  Fly   400 PTSASTSAPP 409
            |..||...||
  Rat   234 PGPASKQVPP 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vsx2NP_001284897.1 Homeobox 233..286 CDD:278475 32/52 (62%)
OAR 556..570 CDD:281777
DrgxNP_665710.2 Homeobox 37..90 CDD:395001 33/52 (63%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 88..135 7/48 (15%)
OAR 201..218 CDD:397759 2/16 (13%)
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 204..217 2/12 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 219..263 10/26 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D454642at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.