DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vsx2 and dsc-1

DIOPT Version :9

Sequence 1:NP_001284897.1 Gene:Vsx2 / 31469 FlyBaseID:FBgn0263512 Length:645 Species:Drosophila melanogaster
Sequence 2:NP_510497.1 Gene:dsc-1 / 181599 WormBaseID:WBGene00001096 Length:310 Species:Caenorhabditis elegans


Alignment Length:229 Identity:73/229 - (31%)
Similarity:103/229 - (44%) Gaps:30/229 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 SVSEPQQQPQQQQQEQQHHQPHHHQYREHHQMTMAAASRMAYFNA-HAAVAAAFMPHQLAAAVHH 138
            ||:.....|..||..||.|.|.:        :....|.|.:..:: ||....|...|.|..|:|:
 Worm    27 SVTTDFSVPPVQQGAQQFHPPRN--------LGPQLARRWSCGDSQHADEPPASYYHNLGVALHN 83

  Fly   139 HHQHQHQHH-----------PHHHPHHPHGAVGGPPPPPPMQHHHPHHPHHPLLHAQGFPQL--K 190
            |.|..:||:           |....|.    .|..|...|..|.....||....||.|...:  .
 Worm    84 HFQMSNQHYLSDFDCPTTVSPISSAHE----TGQLPQLSPYDHIGNQDPHMFSPHAYGNSMIPDN 144

  Fly   191 SFAAGAGTCLPGSLAPKDFGMESLNGFGVGPNSKKKKKKRRHSRTIFTSYQLEKLEEAFKEAHYP 255
            |:...|..    |::..:.|..:||...:..::.:....||..||.||..|...||::|||:|||
 Worm   145 SYFENASR----SISAPNVGNSTLNPSLMSSDNAQSCGGRRRFRTNFTELQSTFLEDSFKESHYP 205

  Fly   256 DVYAREMLSLKTELPEDRIQVWFQNRRAKWRKTE 289
            |..|::.::...::|||||.|||||||||||:.|
 Worm   206 DHKAKKYMADFLKIPEDRITVWFQNRRAKWRRKE 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vsx2NP_001284897.1 Homeobox 233..286 CDD:278475 29/52 (56%)
OAR 556..570 CDD:281777
dsc-1NP_510497.1 Homeobox 184..236 CDD:278475 29/51 (57%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0494
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.