DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vsx2 and ceh-10

DIOPT Version :9

Sequence 1:NP_001284897.1 Gene:Vsx2 / 31469 FlyBaseID:FBgn0263512 Length:645 Species:Drosophila melanogaster
Sequence 2:NP_498251.1 Gene:ceh-10 / 175811 WormBaseID:WBGene00000435 Length:344 Species:Caenorhabditis elegans


Alignment Length:157 Identity:98/157 - (62%)
Similarity:117/157 - (74%) Gaps:12/157 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   213 SLNGFGVGPNSKKKKKKRRHSRTIFTSYQLEKLEEAFKEAHYPDVYAREMLSLKTELPEDRIQVW 277
            |..|...|...|..|:|:|..|||||.||:::||:||:::||||:||||:|:.||||.|||||||
 Worm   119 SSGGGSSGGGGKASKRKKRRHRTIFTQYQIDELEKAFQDSHYPDIYAREVLAGKTELQEDRIQVW 183

  Fly   278 FQNRRAKWRKTEKVWGGSTIMAEYGLYGAMVRHSLPLPDTILKSAKDND---AVAPWLLGMEQKC 339
            |||||||||||||.||.|||||||||||||||||||||:||.|||:..|   :.||||||     
 Worm   184 FQNRRAKWRKTEKTWGKSTIMAEYGLYGAMVRHSLPLPETITKSAEAADPQQSAAPWLLG----- 243

  Fly   340 MHRKSIEA----QSALKDDSGVSDHED 362
            ||:||:||    :|..|.|...||.:|
 Worm   244 MHKKSMEAAAHLESVEKCDMSDSDDDD 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vsx2NP_001284897.1 Homeobox 233..286 CDD:278475 38/52 (73%)
OAR 556..570 CDD:281777
ceh-10NP_498251.1 Homeobox 139..192 CDD:278475 38/52 (73%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160737
Domainoid 1 1.000 97 1.000 Domainoid score I4546
eggNOG 1 0.900 - - E1_KOG0494
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002963
OrthoInspector 1 1.000 - - otm14737
orthoMCL 1 0.900 - - OOG6_109254
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2566
SonicParanoid 1 1.000 - - X5856
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.630

Return to query results.
Submit another query.