DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vsx2 and Vsx2

DIOPT Version :9

Sequence 1:NP_001284897.1 Gene:Vsx2 / 31469 FlyBaseID:FBgn0263512 Length:645 Species:Drosophila melanogaster
Sequence 2:XP_017449515.1 Gene:Vsx2 / 171360 RGDID:621215 Length:380 Species:Rattus norvegicus


Alignment Length:316 Identity:129/316 - (40%)
Similarity:159/316 - (50%) Gaps:95/316 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   154 HPHGAVGGPPPPPPMQHHHPHHPHHPLLHAQGFPQLKSFAAGAGTC-------LPGSLAPKDFGM 211
            ||..|:.|..            |.| ||.|:....    .||.|:.       |||..|...| :
  Rat    48 HPRAALDGLA------------PGH-LLAARSVLS----PAGVGSMGLLGPGGLPGFYAQPTF-L 94

  Fly   212 ESLN----------GFGVGP--------------------------NSKKKKKKRRHSRTIFTSY 240
            |.|:          |...||                          |..||:||||| |||||||
  Rat    95 EVLSDPQSVHLQPLGRASGPLDTSQTASSDSEDVSSSDRKMSKSALNQTKKRKKRRH-RTIFTSY 158

  Fly   241 QLEKLEEAFKEAHYPDVYAREMLSLKTELPEDRIQVWFQNRRAKWRKTEKVWGGSTIMAEYGLYG 305
            |||:||:||.|||||||||||||::||||||||||||||||||||||.||.||.|::||||||||
  Rat   159 QLEELEKAFNEAHYPDVYAREMLAMKTELPEDRIQVWFQNRRAKWRKREKCWGRSSVMAEYGLYG 223

  Fly   306 AMVRHSLPLPDTILKSAKDN--DAVAPWLL---GMEQKC-----------MHRKSIEAQS----- 349
            ||||||:|||::|||||||.  |:.|||||   |..::.           ||:||:||.:     
  Rat   224 AMVRHSIPLPESILKSAKDGIMDSCAPWLLVQDGFPRRFSKPEYQQFFLGMHKKSLEAAAESGRK 288

  Fly   350 ------------ALKDDSGVSDHEDSAGSKSAHSEDLSRSRCHALSSSTESLNVVS 393
                        .::.:....|.:.:...:......::..|..|...||:.|..||
  Rat   289 PEVERQVLPKLDKMEQEERAPDAQAAISQEELRENSIAALRAKAQEHSTKVLGTVS 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vsx2NP_001284897.1 Homeobox 233..286 CDD:278475 46/52 (88%)
OAR 556..570 CDD:281777
Vsx2XP_017449515.1 Homeobox 153..205 CDD:395001 44/51 (86%)
OAR 319..337 CDD:397759
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 109 1.000 Domainoid score I6220
eggNOG 1 0.900 - - E1_KOG0494
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002963
OrthoInspector 1 1.000 - - otm45313
orthoMCL 1 0.900 - - OOG6_109254
Panther 1 1.100 - - O PTHR46892
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X5856
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.770

Return to query results.
Submit another query.