DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vsx2 and Alx3

DIOPT Version :9

Sequence 1:NP_001284897.1 Gene:Vsx2 / 31469 FlyBaseID:FBgn0263512 Length:645 Species:Drosophila melanogaster
Sequence 2:NP_031467.1 Gene:Alx3 / 11694 MGIID:1277097 Length:343 Species:Mus musculus


Alignment Length:324 Identity:91/324 - (28%)
Similarity:124/324 - (38%) Gaps:109/324 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 PHHHPHHPHG------AVGGP-------PPPPPMQHHHPHHPHHPLLH----------------- 182
            ||.||..|.|      ...||       |..||.::.....| .|:|:                 
Mouse    36 PHLHPAPPRGPRLSRFPACGPLEPYLPEPAKPPAKYLQDLGP-GPVLNGGHFYEGSAEAEEKASK 99

  Fly   183 AQGFPQL------------KSFAAGAGTCLPGSLAPKDFGMESLNGFGVGPNS---KKKKKKRRH 232
            |..||||            .:..|..|.||.....|...|:         |:|   .|.|.|:|.
Mouse   100 AASFPQLPVDCRGGPRDGPSNVQASPGPCLASLSVPLSPGL---------PDSMELAKTKSKKRR 155

  Fly   233 SRTIFTSYQLEKLEEAFKEAHYPDVYAREMLSLKTELPEDRIQVWFQNRRAKWRKTEKVWGGSTI 297
            :||.|:::|||:||:.|::.|||||||||.|:|:|:|.|.|:|||||||||||||.|:       
Mouse   156 NRTTFSTFQLEELEKVFQKTHYPDVYAREQLALRTDLTEARVQVWFQNRRAKWRKRER------- 213

  Fly   298 MAEYGLYGAMVRHSLPLPDTILKSAKDNDAVAPWLLGMEQKCMHRKSIEAQSALKDDSGVSDHED 362
                  ||.|                 .:...|:....:...:.|.....|  |::....|....
Mouse   214 ------YGKM-----------------QEGRNPFTTAYDISVLPRTDSHPQ--LQNSLWPSPGSG 253

  Fly   363 SAGSKSAHSEDLSRSRCHALSSSTESLNVVSPAPSSCPTSASTSAPPTSTSGYAGAASSAATTP 426
            |.|....              .|.|.:    |:|...|.|.|..    :.:|:.|..:|.|..|
Mouse   254 SPGGPCL--------------MSPEGI----PSPCMSPYSHSHG----NVAGFMGVPASPAAHP 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vsx2NP_001284897.1 Homeobox 233..286 CDD:278475 34/52 (65%)
OAR 556..570 CDD:281777
Alx3NP_031467.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..122 19/86 (22%)
SP2 32..>141 CDD:281067 25/114 (22%)
Homeobox 157..209 CDD:278475 34/51 (67%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 309..343
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D454642at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
43.880

Return to query results.
Submit another query.