DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vsx2 and lhx4

DIOPT Version :9

Sequence 1:NP_001284897.1 Gene:Vsx2 / 31469 FlyBaseID:FBgn0263512 Length:645 Species:Drosophila melanogaster
Sequence 2:XP_002937009.3 Gene:lhx4 / 100497384 XenbaseID:XB-GENE-492744 Length:376 Species:Xenopus tropicalis


Alignment Length:242 Identity:63/242 - (26%)
Similarity:92/242 - (38%) Gaps:68/242 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   231 RHSRTIFTSYQLEKLEEAFKEAHYPDVYAREMLSLKTELPEDRIQVWFQNRRAKWRKTEKVWGGS 295
            :..||..|:.|||.|:.|:|.:..|..:.||.||.:|.|....:||||||||||.::.:|..|  
 Frog   158 KRPRTTITAKQLETLKNAYKNSPKPARHVREQLSSETGLDMRVVQVWFQNRRAKEKRLKKDAG-- 220

  Fly   296 TIMAEYGLYGAMVRHSLPLPDTILKSAKDNDAVAPWLLGMEQKCMHRKSIEAQSALKDDSGVSDH 360
              ...:|.:...||.|     .:.||.|::..                         :|.||||.
 Frog   221 --RQRWGQFYKSVRKS-----RLGKSGKESST-------------------------EDCGVSDS 253

  Fly   361 EDSAGSKSAHSEDLSRSRCHA-----------------LSSSTESLNVVSP-----APSSCPTSA 403
            |.|...:...||..|....::                 ...|.:.|:..||     :|||. :|.
 Frog   254 ELSYRDEQILSELGSSGGIYSSGGDLVPLVNGGFTMDGTGQSYQDLHDSSPYEMPQSPSSI-SSL 317

  Fly   404 STSAPPTSTSGYAGAASS-----AATTPTGASTTNSSSSPHIELGSP 445
            .:...|.:....||..:.     ....||...:|.||      :|.|
 Frog   318 PSHGLPYNMDNAAGLLNHPPLRVLPAAPTSDISTESS------MGYP 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vsx2NP_001284897.1 Homeobox 233..286 CDD:278475 26/52 (50%)
OAR 556..570 CDD:281777
lhx4XP_002937009.3 LIM1_Lhx4 30..81 CDD:188852
LIM2_Lhx3_Lhx4 89..144 CDD:188762
Homeobox 160..214 CDD:395001 26/53 (49%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1174754at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.