DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vsx2 and rax2

DIOPT Version :9

Sequence 1:NP_001284897.1 Gene:Vsx2 / 31469 FlyBaseID:FBgn0263512 Length:645 Species:Drosophila melanogaster
Sequence 2:XP_002941436.1 Gene:rax2 / 100494721 XenbaseID:XB-GENE-494483 Length:227 Species:Xenopus tropicalis


Alignment Length:213 Identity:66/213 - (30%)
Similarity:97/213 - (45%) Gaps:39/213 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   207 KDFGMESLNGFGVGPNSKKKKKKRRHSRTIFTSYQLEKLEEAFKEAHYPDVYAREMLSLKTELPE 271
            ::.|.....|...|.:::..|||.|.:||.||:|||.:||.||:.:||||||:||.|::|..|||
 Frog    13 REDGSTPTPGTPEGEDNELPKKKHRRNRTTFTTYQLHELERAFERSHYPDVYSREELAMKVSLPE 77

  Fly   272 DRIQVWFQNRRAKWRKTEKVWGGSTIMAEYGLY----GAMVRHSLPLPDTILKSAKDNDAVAPWL 332
            .|:||||||||||||:.||:...|:.:.:..|.    ..|.....||.:|:        .:.|||
 Frog    78 VRVQVWFQNRRAKWRRQEKLETSSSKLHDSPLLSFSRSPMATGVGPLSNTL--------PLEPWL 134

  Fly   333 LGMEQKCMHRKSIEAQSALKDDSGVSDHEDSAGSKSAHSEDLSRSRCHALSSSTESLNVVSPAPS 397
            .                           ....|:.:.||.....:...||..:.:|...::..|.
 Frog   135 T---------------------------SPIPGTTTVHSMPAFMAPSQALQPTYQSHTFLNSGPP 172

  Fly   398 SCPTSASTSAPPTSTSGY 415
            ..|....:.||.....|:
 Frog   173 MTPIQPLSGAPYQCMGGF 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vsx2NP_001284897.1 Homeobox 233..286 CDD:278475 35/52 (67%)
OAR 556..570 CDD:281777
rax2XP_002941436.1 Homeobox 40..93 CDD:365835 36/52 (69%)
OAR 200..216 CDD:367680
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D454642at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.