DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vsx2 and drgx

DIOPT Version :9

Sequence 1:NP_001284897.1 Gene:Vsx2 / 31469 FlyBaseID:FBgn0263512 Length:645 Species:Drosophila melanogaster
Sequence 2:XP_004915967.1 Gene:drgx / 100493837 XenbaseID:XB-GENE-993712 Length:263 Species:Xenopus tropicalis


Alignment Length:276 Identity:85/276 - (30%)
Similarity:128/276 - (46%) Gaps:38/276 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   187 PQLKSFAAGAGTCLPGSLAPKDFGMESLNGFGVGPNSKKKKKKRRHSRTIFTSYQLEKLEEAFKE 251
            |||:     .|:...|:.|..:|.    :||        .::|:|.:||.||..|||.||..|.:
 Frog     8 PQLE-----VGSPPFGAHAASEFD----DGF--------LRRKQRRNRTTFTLQQLEALEAVFAQ 55

  Fly   252 AHYPDVYAREMLSLKTELPEDRIQVWFQNRRAKWRKTEKVWGGSTIMAEYGLYGAMVRHSLPLPD 316
            .|||||:.||.|::|..|.|.|:|||||||||||||||:   ||....     ||  :.|.|...
 Frog    56 THYPDVFTREELAMKINLTEARVQVWFQNRRAKWRKTER---GSCEQE-----GA--KESAPEVT 110

  Fly   317 TILKSAKDNDAVAP-----WLLGMEQKCM-HRKSIEAQSALKDD--SGVSDHEDSAGSKSAHSED 373
            |..::...:..|.|     ..|..:|:|: |.:::.:.::....  .|...:..|.....:|...
 Frog   111 TAGRNLSPSSTVEPVRGKKETLEAQQRCLSHDRAVGSATSFFPSCLPGALLNTASYAQALSHVAS 175

  Fly   374 LSRS-RCHALSSSTESLNVVSPAPSSCPTSASTSAPPTSTSGYAGAA-SSAATTPTGASTTNSSS 436
            |..| .|....|....|:.:.|.......:||.:|.......::.|. .||...|:..::|.:|:
 Frog   176 LKGSPLCSCCVSDPLGLSFLPPYGCQSHRTASVAALRMKAREHSEAVLQSAQLLPSAGNSTGASA 240

  Fly   437 SPHIELGSPS-PQQQQ 451
            |..:|.|... ||.:|
 Frog   241 SAPLEGGHERVPQAEQ 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vsx2NP_001284897.1 Homeobox 233..286 CDD:278475 32/52 (62%)
OAR 556..570 CDD:281777
drgxXP_004915967.1 Homeobox 38..91 CDD:395001 33/52 (63%)
OAR 204..220 CDD:397759 3/15 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D454642at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.