DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vsx2 and lhx3

DIOPT Version :9

Sequence 1:NP_001284897.1 Gene:Vsx2 / 31469 FlyBaseID:FBgn0263512 Length:645 Species:Drosophila melanogaster
Sequence 2:XP_031747852.1 Gene:lhx3 / 100489308 XenbaseID:XB-GENE-490075 Length:403 Species:Xenopus tropicalis


Alignment Length:216 Identity:60/216 - (27%)
Similarity:95/216 - (43%) Gaps:33/216 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   224 KKKKKKRRHSRTIFTSYQLEKLEEAFKEAHYPDVYAREMLSLKTELPEDRIQVWFQNRRAKWRKT 288
            ::.:...:..||..|:.|||.|:.|:..:..|..:.||.||.:|.|....:||||||||||.::.
 Frog   156 REAESTAKRPRTTITAKQLETLKNAYNNSPKPARHVREQLSSETGLDMRVVQVWFQNRRAKEKRL 220

  Fly   289 EKVWGGSTIMAEYGLYGAMVR----HSLPLPDTILKSAKDNDAVA-----PWLLGMEQKCMHRKS 344
            :|..|    ...:|.|...::    :|....|:|.:...|:||..     |.:..|.    |...
 Frog   221 KKDAG----RQRWGQYFRNMKRSRGNSKSDKDSIQEEGPDSDAEVSFTDEPSMSEMN----HSNG 277

  Fly   345 IEAQSALKDDSGVSDHEDSAGSKSAHSEDLSRSRCH-ALSSSTESLNVVSPAPSSCPTS-ASTSA 407
            |  .:::.|.|.|...:  |||....|.:      | .:.:..:..|:.|.:|...|.| ||..:
 Frog   278 I--YNSMNDTSPVLGRQ--AGSNGPFSLE------HGGIPTQDQYHNLRSNSPYGIPQSPASLQS 332

  Fly   408 PPTSTSGYAGAASSAATTPTG 428
            .|    |:....|:.|...||
 Frog   333 MP----GHQSLLSNLAFPDTG 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vsx2NP_001284897.1 Homeobox 233..286 CDD:278475 25/52 (48%)
OAR 556..570 CDD:281777
lhx3XP_031747852.1 LIM1_Lhx3b 33..87 CDD:188851
LIM2_Lhx3_Lhx4 95..150 CDD:188762
Homeobox 165..219 CDD:395001 25/53 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1174754at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.