DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vsx2 and arx

DIOPT Version :10

Sequence 1:NP_001284897.1 Gene:Vsx2 / 31469 FlyBaseID:FBgn0263512 Length:645 Species:Drosophila melanogaster
Sequence 2:XP_002933659.1 Gene:arx / 100486727 XenbaseID:XB-GENE-483940 Length:536 Species:Xenopus tropicalis


Alignment Length:47 Identity:13/47 - (27%)
Similarity:19/47 - (40%) Gaps:8/47 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 IFFLNFRRLP--------NTDYNDLASNNVKSIGRSLHLPGKSGRIG 79
            :|.|.|.|..        |:..|:..:..|:||.|.|.....:.|.|
 Frog    51 LFALEFARRRAQLVLWDINSQSNEETAEMVRSIYRELEAEDSARRAG 97

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vsx2NP_001284897.1 Homeodomain 230..287 CDD:459649
OAR 556..572 CDD:461067
arxXP_002933659.1 Homeodomain 302..358 CDD:459649
OAR 500..518 CDD:461067
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.