DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vsx2 and phox2b

DIOPT Version :9

Sequence 1:NP_001284897.1 Gene:Vsx2 / 31469 FlyBaseID:FBgn0263512 Length:645 Species:Drosophila melanogaster
Sequence 2:NP_001116492.1 Gene:phox2b / 100124329 XenbaseID:XB-GENE-1000415 Length:293 Species:Xenopus tropicalis


Alignment Length:308 Identity:91/308 - (29%)
Similarity:116/308 - (37%) Gaps:103/308 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   183 AQGF---PQLKSFAAGAGTCLPGSLAPKDFGMESLNGFGVGP------------NSKKKKKKRRH 232
            |.||   |...:|.|.:| |  .||.|....:.:|......|            ....:|:|:|.
 Frog    39 ASGFQYNPIRTTFGATSG-C--PSLTPGSCSLGTLRDHQSSPYAAVPYKLFTDHGGLNEKRKQRR 100

  Fly   233 SRTIFTSYQLEKLEEAFKEAHYPDVYAREMLSLKTELPEDRIQVWFQNRRAKWRKTEKVWGGSTI 297
            .||.|||.||::||..|.|.||||:|.||.|:||.:|.|.|:||||||||||:||.|:....:..
 Frog   101 IRTTFTSAQLKELERVFAETHYPDIYTREELALKIDLTEARVQVWFQNRRAKFRKQERAAAAAAA 165

  Fly   298 MAEYGLYGAMVRHSLPLPDTILKSAKDNDAVAPWLLGMEQKCMHRKSIEAQSALKDDSGVSDHED 362
            .|:.|                                             .|..|.||  |..|:
 Frog   166 AAKNG---------------------------------------------SSGKKSDS--SRDEE 183

  Fly   363 SAGSKSAHSEDLSRSRCHALSSSTESLNVVSPAPSSC-----PTSASTSAPP------------- 409
            |..||||..:           |:....|..:|.| ||     |:.|..:..|             
 Frog   184 SKDSKSADPD-----------STGGPGNNPNPTP-SCGGGPSPSGAQGNGVPQEPGKVGVPGPGS 236

  Fly   410 -TSTS--GYAGAASSAATTPTGASTTNSSSSPHIELGSPSPQQQQHLQ 454
             ||.|  |.:|.....||.|.|..|:...|     ||.|.......||
 Frog   237 LTSASVVGVSGGPQGWATGPGGTITSIPDS-----LGGPFASVLSSLQ 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vsx2NP_001284897.1 Homeobox 233..286 CDD:278475 34/52 (65%)
OAR 556..570 CDD:281777
phox2bNP_001116492.1 Homeobox 102..154 CDD:278475 34/51 (67%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.