DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vsx2 and vsx1

DIOPT Version :9

Sequence 1:NP_001284897.1 Gene:Vsx2 / 31469 FlyBaseID:FBgn0263512 Length:645 Species:Drosophila melanogaster
Sequence 2:NP_001093670.1 Gene:vsx1 / 100101658 XenbaseID:XB-GENE-853166 Length:344 Species:Xenopus tropicalis


Alignment Length:187 Identity:103/187 - (55%)
Similarity:131/187 - (70%) Gaps:24/187 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   222 NSKKKKKKRRHSRTIFTSYQLEKLEEAFKEAHYPDVYAREMLSLKTELPEDRIQVWFQNRRAKWR 286
            :|:.|:||||| ||:||::|||:||:||.|||||||||||||:||||||||||||||||||||||
 Frog   143 SSQAKRKKRRH-RTVFTAHQLEELEKAFNEAHYPDVYAREMLALKTELPEDRIQVWFQNRRAKWR 206

  Fly   287 KTEKVWGGSTIMAEYGLYGAMVRHSLPLPDTILKSAKDN--DAVAPWLLGMEQKCMHRKSIE--- 346
            |.||.||.|::||||||||||||||:|||::|:.|||:.  .:.||||||     ||:||::   
 Frog   207 KREKCWGRSSVMAEYGLYGAMVRHSIPLPESIINSAKNGLVGSCAPWLLG-----MHKKSVDITR 266

  Fly   347 ----AQSALKDDSGVSDHEDSAGSKS---------AHSEDLSRSRCHALSSSTESLN 390
                ...|::...|.|..:|.....|         ::|.|:|..|...|||:.:..|
 Frog   267 TVDPEDMAIERSKGKSHVDDFTNRHSEFHRSPRQQSNSMDISEERAIDLSSTAKQEN 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vsx2NP_001284897.1 Homeobox 233..286 CDD:278475 44/52 (85%)
OAR 556..570 CDD:281777
vsx1NP_001093670.1 Homeobox 153..207 CDD:365835 46/54 (85%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 109 1.000 Domainoid score I6281
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002963
OrthoInspector 1 1.000 - - otm48385
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.