DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12730 and MARVELD1

DIOPT Version :9

Sequence 1:NP_001284896.1 Gene:CG12730 / 31466 FlyBaseID:FBgn0029771 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_113672.1 Gene:MARVELD1 / 83742 HGNCID:28674 Length:173 Species:Homo sapiens


Alignment Length:169 Identity:43/169 - (25%)
Similarity:63/169 - (37%) Gaps:42/169 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 GTQDYDRKYLLSMPGLCKLACLLCSFVGILCIIC----GPVRVSNFRG-SFYLAVVTIGFVATGC 64
            |.....|.:|.|..|:.:|..||......:.|..    |||..:.|.. .|:|..:.:.|:.   
Human    18 GAVRLQRPFLRSPLGVLRLLQLLAGAAFWITIATSKYQGPVHFALFVSVLFWLLTLGLYFLT--- 79

  Fly    65 LLLARYLRLWQRQFCRCDPTL---WSL--AVHSSLALA-YFTASGLV----------------LS 107
             ||.::         ...|.|   |.:  ..|..||.| |..|:|::                |.
Human    80 -LLGKH---------ELVPVLGSRWLMVNVAHDVLAAALYGAATGIMSDQMQRHSYCNLKDYPLP 134

  Fly   108 LDIGAYTAAAFFGLTAFCINGLEA-YGNYRRSR-QREVA 144
            ....|:.|||..|.....:..|.| ||..||.: ::|||
Human   135 CAYHAFLAAAVCGGVCHGLYLLSALYGCGRRCQGKQEVA 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12730NP_001284896.1 None
MARVELD1NP_113672.1 MARVEL 26..160 CDD:366555 34/146 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4788
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22776
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.