DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12730 and Cmtm2b

DIOPT Version :10

Sequence 1:NP_572228.1 Gene:CG12730 / 31466 FlyBaseID:FBgn0029771 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_082800.1 Gene:Cmtm2b / 75502 MGIID:2447311 Length:210 Species:Mus musculus


Alignment Length:92 Identity:21/92 - (22%)
Similarity:36/92 - (39%) Gaps:22/92 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 AVVTIGFVATGCLLLARYLRLWQRQFCRCDPTLWSLAVH--------------SSLALAYFTASG 103
            |:|....|||..:::  .|...:...|.....|:|||::              :.||.:.|...|
Mouse    54 AMVCFQRVATHPIVI--LLLTMELSICAFFFFLYSLAINRYIPFVFWPMMDLMNDLACSTFLIGG 116

  Fly   104 LVLSLD------IGAYTAAAFFGLTAF 124
            :..:|:      :...|.....|:|||
Mouse   117 IFFALEARRELPVPYLTGMILMGVTAF 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12730NP_572228.1 None
Cmtm2bNP_082800.1 MARVEL 35..151 CDD:366555 21/92 (23%)

Return to query results.
Submit another query.