powered by:
Protein Alignment CG12730 and Cklf
DIOPT Version :9
Sequence 1: | NP_001284896.1 |
Gene: | CG12730 / 31466 |
FlyBaseID: | FBgn0029771 |
Length: | 148 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_083571.1 |
Gene: | Cklf / 75458 |
MGIID: | 1922708 |
Length: | 152 |
Species: | Mus musculus |
Alignment Length: | 53 |
Identity: | 14/53 - (26%) |
Similarity: | 22/53 - (41%) |
Gaps: | 4/53 - (7%) |
- Green bases have known domain annotations that are detailed below.
Fly 25 CLLCSFVGILCIICGPVRVSNFRGSFYLAVVTIGFVATGCLLLARYLRLWQRQ 77
|:| .|.:|.:|......:...|.| ..:|:......|.|:.:.||...||
Mouse 90 CML--IVSVLALIPETSTKTILGGVF--GFLTVTCTIADCALMCQKLRFRPRQ 138
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG12730 | NP_001284896.1 |
None |
Cklf | NP_083571.1 |
MARVEL |
13..127 |
CDD:296526 |
9/40 (23%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4788 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR22776 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 2.000 |
|
Return to query results.
Submit another query.