DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12730 and Cklf

DIOPT Version :10

Sequence 1:NP_572228.1 Gene:CG12730 / 31466 FlyBaseID:FBgn0029771 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_083571.1 Gene:Cklf / 75458 MGIID:1922708 Length:152 Species:Mus musculus


Alignment Length:53 Identity:14/53 - (26%)
Similarity:22/53 - (41%) Gaps:4/53 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 CLLCSFVGILCIICGPVRVSNFRGSFYLAVVTIGFVATGCLLLARYLRLWQRQ 77
            |:|  .|.:|.:|......:...|.|  ..:|:......|.|:.:.||...||
Mouse    90 CML--IVSVLALIPETSTKTILGGVF--GFLTVTCTIADCALMCQKLRFRPRQ 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12730NP_572228.1 None
CklfNP_083571.1 MARVEL 13..127 CDD:383772 9/40 (23%)

Return to query results.
Submit another query.