DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12730 and Cmtm3

DIOPT Version :9

Sequence 1:NP_001284896.1 Gene:CG12730 / 31466 FlyBaseID:FBgn0029771 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_077179.1 Gene:Cmtm3 / 68119 MGIID:2447162 Length:184 Species:Mus musculus


Alignment Length:132 Identity:38/132 - (28%)
Similarity:53/132 - (40%) Gaps:27/132 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 RKYLLSMPGLCKLACLLCSFVGILCIICGPVRVSNFRGSFYLAVVTIGFVATGCLLLARYLRL-- 73
            |.:|.|:.|...||....||:..:|.:     ||:  .|.:|.|..:.|:.....|.|..::|  
Mouse    34 RAFLCSLKGRLLLAESGLSFITFICYV-----VSS--ASAFLTVPLLEFLLAVYFLFADAMQLND 91

  Fly    74 -WQ------RQFCRCDPTLWSLAVHSSLALAYFTAS-GLVLSLDIGAYTAAAFFGLTAFCINGLE 130
             ||      ..|.||          .:.||.||..| ..|.....|||.||..||..|..:..::
Mouse    92 KWQGLCWPMMDFLRC----------VTAALIYFVISITAVAKYSDGAYKAAGVFGFFATIVFAID 146

  Fly   131 AY 132
            .|
Mouse   147 FY 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12730NP_001284896.1 None
Cmtm3NP_077179.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22
MARVEL 36..149 CDD:366555 37/130 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 163..184
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4788
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22776
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.