DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12730 and myadml2

DIOPT Version :9

Sequence 1:NP_001284896.1 Gene:CG12730 / 31466 FlyBaseID:FBgn0029771 Length:148 Species:Drosophila melanogaster
Sequence 2:XP_005171708.1 Gene:myadml2 / 570494 -ID:- Length:303 Species:Danio rerio


Alignment Length:155 Identity:35/155 - (22%)
Similarity:52/155 - (33%) Gaps:50/155 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 YLLSMPGLCK-----LACLL------------------CSFVGILCIICGPV--------RVSNF 46
            |:.::.||.|     :||::                  |..|..||.....|        |.|:.
Zfish   153 YMATVSGLLKVVQAFIACIIFGALHNDSQYNRHIPTQYCVVVYSLCFAVTVVVVALTVSGRTSSL 217

  Fly    47 RGSFYLAVVTIGFVATGCLLLARYLRLW-----QRQF--------CRCDPTLWSLAVHSSLALAY 98
            |..|...||...|:|.  ||......:|     .:::        |......|.    |.|.:|.
Zfish   218 RFPFDRFVVIYTFLAV--LLYLSAAVIWPVFSFDKKYGAPGRPDDCPKGKCPWD----SKLVIAV 276

  Fly    99 FTASGLVLSLDIGAYTAAAFFGLTA 123
            ||.:.|||......|:....|.|::
Zfish   277 FTCANLVLYFTDLVYSQRIRFVLSS 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12730NP_001284896.1 None
myadml2XP_005171708.1 MARVEL 13..142 CDD:279608
MARVEL 153..291 CDD:279608 32/143 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4788
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.