DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12730 and cmtm7

DIOPT Version :9

Sequence 1:NP_001284896.1 Gene:CG12730 / 31466 FlyBaseID:FBgn0029771 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_001123586.1 Gene:cmtm7 / 559138 ZFINID:ZDB-GENE-041111-174 Length:162 Species:Danio rerio


Alignment Length:130 Identity:32/130 - (24%)
Similarity:56/130 - (43%) Gaps:11/130 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 YLLSMPGLCKLACLLCSFVGILCIICGPVRVSNFRGSFYLAVVTIGFVATGCLLLARYL-RLWQR 76
            |:.|..||.|:..::...:..||:.| ..|.:::....|..|||..|:.........:| ||..:
Zfish    26 YVRSFQGLLKIGQVVTLLIAFLCVHC-EQRWTDYSAFRYFEVVTAWFLIVFFFFFLMHLFRLQSK 89

  Fly    77 QFCRCDPTLWSLA--VHSSL-ALAYFTASGLVL--SLDIGAYTAAAFFGLTAFCINGLEAYGNYR 136
            ..|    ..|:|.  :|.:: .:..|.||.:|.  |..|....|.:.||..|..:..:..:.:|:
Zfish    90 ITC----INWTLTEFLHYAVGGILVFIASIVVAVKSYGISGLIAGSVFGFMATFLIAISIWTSYK 150

  Fly   137  136
            Zfish   151  150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12730NP_001284896.1 None
cmtm7NP_001123586.1 MARVEL 26..146 CDD:279608 31/124 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4788
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1520058at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22776
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.