DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12730 and pllp

DIOPT Version :9

Sequence 1:NP_001284896.1 Gene:CG12730 / 31466 FlyBaseID:FBgn0029771 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_001116171.1 Gene:pllp / 558650 ZFINID:ZDB-GENE-050419-195 Length:173 Species:Danio rerio


Alignment Length:153 Identity:39/153 - (25%)
Similarity:64/153 - (41%) Gaps:23/153 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 DRKYLLSMPGLCKLACLLCSFVGIL---CIICGPVRVSNFRGSFYLAVVTIGFVATGCLLLARYL 71
            |..::.|:||:..:|.::   ||:|   .|...|..:....|......:|:..::. .||:...|
Zfish    28 DMGFIKSIPGILLIAEIV---VGLLVWTLIASTPHYLIPALGWVLFVSITLWLLSI-ALLVILLL 88

  Fly    72 RLWQRQFCRCDPTL-WSLAV---HSSLALAYFTASGLVLSLDIGAY-----TAAAFFGLTAFCIN 127
            .|.||.     |:: |.|.:   :|..||.|.||.....:...|.|     .|:||||:....:.
Zfish    89 SLHQRL-----PSVPWPLVLLVFYSVAALLYLTAFLANAATVPGGYYQGHLGASAFFGIVETLLY 148

  Fly   128 GLEAYGNYR--RSRQREVATQTI 148
            ...:|..|.  |...:..|..|:
Zfish   149 TASSYFAYLGWRGEGQNAAGSTV 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12730NP_001284896.1 None
pllpNP_001116171.1 MARVEL 31..154 CDD:279608 33/131 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4788
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR22776
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.