DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12730 and CMTM6

DIOPT Version :10

Sequence 1:NP_572228.1 Gene:CG12730 / 31466 FlyBaseID:FBgn0029771 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_060271.1 Gene:CMTM6 / 54918 HGNCID:19177 Length:183 Species:Homo sapiens


Alignment Length:84 Identity:20/84 - (23%)
Similarity:28/84 - (33%) Gaps:30/84 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 RKYLLSMPGLCKLACLLCSFVGILCIICGP------VRVSNFRGSFYLAVV-------------- 55
            |:.|..:..|..|...:|..|...|.:||.      |..|.|..|..:.:|              
Human    38 RRVLKGLQLLLSLLAFICEEVVSQCTLCGGLYFFEFVSCSAFLLSLLILIVYCTPFYERVDTTKV 102

  Fly    56 -------TIGFVATGCLLL 67
                   |:|   |||:.|
Human   103 KSSDFYITLG---TGCVFL 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12730NP_572228.1 None
CMTM6NP_060271.1 MARVEL <61..153 CDD:366555 14/61 (23%)

Return to query results.
Submit another query.