DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12730 and cmtm7

DIOPT Version :10

Sequence 1:NP_572228.1 Gene:CG12730 / 31466 FlyBaseID:FBgn0029771 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_001015861.1 Gene:cmtm7 / 548578 XenbaseID:XB-GENE-995961 Length:165 Species:Xenopus tropicalis


Alignment Length:150 Identity:37/150 - (24%)
Similarity:62/150 - (41%) Gaps:42/150 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 DRKYLLSMPGLCKLACLLCSFVGILCIICGPVRVS---NFRGSFYLAVVTIGFVATGCLLLARYL 71
            |..|..|..|:.|.|.::...:|.||     ||.|   ::....|..:|||.|:   .|:...|:
 Frog    27 DTGYARSYSGMLKGAEMVSLLIGFLC-----VRFSIWTDYSAFNYFEIVTISFM---ILIFIFYV 83

  Fly    72 ----RLWQRQFCRCDPTLWSLA--VHSSL------------ALAYFTASGLVLSLDIGAYTAAAF 118
                |:::...|    ..|.||  :|.::            |:..:|.||||:....|       
 Frog    84 INIFRIYRMLTC----ISWPLAELLHYAIGIFLLFIASIVAAVKSYTISGLVVGSVFG------- 137

  Fly   119 FGLTAFCINGLEAYGNYRRS 138
            |..|..|:  ::.:.:|:.|
 Frog   138 FIATFLCV--MDMWLSYKIS 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12730NP_572228.1 None
cmtm7NP_001015861.1 MARVEL 30..150 CDD:366555 34/140 (24%)

Return to query results.
Submit another query.