DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12730 and cmtm7

DIOPT Version :9

Sequence 1:NP_001284896.1 Gene:CG12730 / 31466 FlyBaseID:FBgn0029771 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_001015861.1 Gene:cmtm7 / 548578 XenbaseID:XB-GENE-995961 Length:165 Species:Xenopus tropicalis


Alignment Length:150 Identity:37/150 - (24%)
Similarity:62/150 - (41%) Gaps:42/150 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 DRKYLLSMPGLCKLACLLCSFVGILCIICGPVRVS---NFRGSFYLAVVTIGFVATGCLLLARYL 71
            |..|..|..|:.|.|.::...:|.||     ||.|   ::....|..:|||.|:   .|:...|:
 Frog    27 DTGYARSYSGMLKGAEMVSLLIGFLC-----VRFSIWTDYSAFNYFEIVTISFM---ILIFIFYV 83

  Fly    72 ----RLWQRQFCRCDPTLWSLA--VHSSL------------ALAYFTASGLVLSLDIGAYTAAAF 118
                |:::...|    ..|.||  :|.::            |:..:|.||||:....|       
 Frog    84 INIFRIYRMLTC----ISWPLAELLHYAIGIFLLFIASIVAAVKSYTISGLVVGSVFG------- 137

  Fly   119 FGLTAFCINGLEAYGNYRRS 138
            |..|..|:  ::.:.:|:.|
 Frog   138 FIATFLCV--MDMWLSYKIS 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12730NP_001284896.1 None
cmtm7NP_001015861.1 MARVEL 30..150 CDD:366555 34/140 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1520058at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22776
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.