DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12730 and Myadm

DIOPT Version :9

Sequence 1:NP_001284896.1 Gene:CG12730 / 31466 FlyBaseID:FBgn0029771 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_001087233.1 Gene:Myadm / 50918 MGIID:1355332 Length:320 Species:Mus musculus


Alignment Length:96 Identity:20/96 - (20%)
Similarity:35/96 - (36%) Gaps:40/96 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 YLLSMPGLCK-----LACLLCSFV-------------------GILCIICG-------------- 39
            |:.::|||.|     :||::.:|:                   .|..|:.|              
Mouse   162 YMATVPGLLKVFETFVACIIFAFISEPLLYNQKPALEWCVAVYAICFILAGVTILLNLGDCTNVL 226

  Fly    40 PVRVSNFRGSFYLAVVTIGFVATGCLLLARY 70
            |:....|...  ||::::.|.||..:|...|
Mouse   227 PIPFPTFLSG--LALLSVLFYATAIVLWPLY 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12730NP_001284896.1 None
MyadmNP_001087233.1 MARVEL 39..146 CDD:366555
MARVEL 162..311 CDD:366555 20/96 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4788
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.