DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12730 and MAL

DIOPT Version :9

Sequence 1:NP_001284896.1 Gene:CG12730 / 31466 FlyBaseID:FBgn0029771 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_002362.1 Gene:MAL / 4118 HGNCID:6817 Length:153 Species:Homo sapiens


Alignment Length:78 Identity:18/78 - (23%)
Similarity:24/78 - (30%) Gaps:32/78 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 FVGILCIICGPVRVSNFRGSFYLAVVTIGFVATGCLLLARYLRLWQRQFCRCDPTLW---SLAVH 91
            ||.:.|                       ||||..|::...:.      .....|.|   ..|.|
Human    57 FVSVFC-----------------------FVATTTLIILYIIG------AHGGETSWVTLDAAYH 92

  Fly    92 SSLALAYFTASGL 104
            .:.||.|.:||.|
Human    93 CTAALFYLSASVL 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12730NP_001284896.1 None
MALNP_002362.1 MARVEL 19..145 CDD:307448 18/78 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4788
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22776
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.