DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12730 and Mall

DIOPT Version :10

Sequence 1:NP_572228.1 Gene:CG12730 / 31466 FlyBaseID:FBgn0029771 Length:148 Species:Drosophila melanogaster
Sequence 2:XP_008760403.1 Gene:Mall / 362211 RGDID:1310869 Length:194 Species:Rattus norvegicus


Alignment Length:95 Identity:20/95 - (21%)
Similarity:33/95 - (34%) Gaps:45/95 - (47%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 SFYLAVVTIGFVATGCLLLARYLRLWQRQFCRCDPTLWSL--AVHSSLALAYFTASGLVLSLDIG 111
            :|:|..:..||              |          :|:|  |.|    :||....|.||     
  Rat    31 AFFLPELVFGF--------------W----------VWTLVAATH----VAYPLLHGWVL----- 62

  Fly   112 AYTAAAFFGLTAFCINGL----EAYGNYRR 137
                  :..||:|.::.:    ..:|.|:|
  Rat    63 ------YVSLTSFLVSLMLLLSYIFGFYKR 86

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12730NP_572228.1 None
MallXP_008760403.1 MARVEL 25..>115 CDD:366555 20/95 (21%)

Return to query results.
Submit another query.