DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12730 and Myadml2

DIOPT Version :9

Sequence 1:NP_001284896.1 Gene:CG12730 / 31466 FlyBaseID:FBgn0029771 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_001121657.1 Gene:Myadml2 / 303744 RGDID:1311499 Length:307 Species:Rattus norvegicus


Alignment Length:136 Identity:32/136 - (23%)
Similarity:46/136 - (33%) Gaps:46/136 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LACLLCSFVGILC------IICGP----VRVSNFR--GSFYLAVVTIGFVATGCLLLARYLRLWQ 75
            ||.|||:...::.      :.|.|    ..|.|||  .|.:..::.:.:.|...|..||      
  Rat    94 LATLLCATAAVIYPLYFTRLECPPEPAGCMVRNFRLAASVFAGLLFLAYAAEVALTRAR------ 152

  Fly    76 RQFCRCDPTLWSLAVHSSLALAYFTASGLVLSLDIGAYTAAAFFGLTAFCINGLEAYGNYRRSRQ 140
                           ...:|....|.|||:..  :.|:.|...||    .:.....||.|     
  Rat   153 ---------------PGQVASYMATVSGLLKI--VQAFVACIIFG----ALVHESRYGRY----- 191

  Fly   141 REVATQ 146
              ||||
  Rat   192 --VATQ 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12730NP_001284896.1 None
Myadml2NP_001121657.1 MARVEL 17..148 CDD:279608 13/53 (25%)
MARVEL 159..297 CDD:279608 15/50 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4788
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.