DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12730 and Cmtm5

DIOPT Version :9

Sequence 1:NP_001284896.1 Gene:CG12730 / 31466 FlyBaseID:FBgn0029771 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_001099504.2 Gene:Cmtm5 / 290214 RGDID:1307045 Length:156 Species:Rattus norvegicus


Alignment Length:140 Identity:33/140 - (23%)
Similarity:56/140 - (40%) Gaps:23/140 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 GTQDY--DRKYLLSMPGLCKLACLLCSFVGILCIICGPVRVSNFRGS----FYLAVVTIGFVATG 63
            |.|.:  |:.:|.|:.|:.....|..:|:   ..||....:|.:..:    |::.:..:...||.
  Rat    19 GLQGFGVDKTFLSSLKGILLETELALTFI---IFICFTASISAYMAAALLEFFITLAFLFLYATQ 80

  Fly    64 CLLLARYLRL-WQ-RQFCRCDPTLWSLAVHSSLALAYFTASGLVLSLDIGAYTAAAFFGLTAFCI 126
            |  ..|:.|| |. ..|.||          .|..:.:...|...::...||..||..||:....:
  Rat    81 C--YQRFDRLNWPCLDFLRC----------LSAIIIFLVVSFAAVTSREGAAIAAFVFGIILVSV 133

  Fly   127 NGLEAYGNYR 136
            ...:|:..||
  Rat   134 FAYDAFKIYR 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12730NP_001284896.1 None
Cmtm5NP_001099504.2 MARVEL 29..139 CDD:279608 27/124 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4788
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22776
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.