DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12730 and Mal

DIOPT Version :10

Sequence 1:NP_572228.1 Gene:CG12730 / 31466 FlyBaseID:FBgn0029771 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_036930.1 Gene:Mal / 25263 RGDID:3037 Length:153 Species:Rattus norvegicus


Alignment Length:49 Identity:15/49 - (30%)
Similarity:18/49 - (36%) Gaps:3/49 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 FVATGCLLLARYLRLWQRQFCRCDPTLW---SLAVHSSLALAYFTASGL 104
            ||:..|.|....|.:..........|.|   ..|.|...||.|.:||.|
  Rat    57 FVSVFCFLATTSLMVMYIIGTHGGETSWITLDAAYHCVAALFYLSASVL 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12730NP_572228.1 None
MalNP_036930.1 MARVEL 19..145 CDD:366555 15/49 (31%)

Return to query results.
Submit another query.