DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12730 and Mall

DIOPT Version :10

Sequence 1:NP_572228.1 Gene:CG12730 / 31466 FlyBaseID:FBgn0029771 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_663507.1 Gene:Mall / 228576 MGIID:2385152 Length:154 Species:Mus musculus


Alignment Length:91 Identity:18/91 - (19%)
Similarity:33/91 - (36%) Gaps:37/91 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 SFYLAVVTIGFVATGCLLLARYLRLWQRQFCRCDPTLWSL--AVHSSLALAYFTASGLVLSLDIG 111
            :|:|..:..||              |          :|:|  |.|    :||....|.||.:.:.
Mouse    31 AFFLPELVFGF--------------W----------VWTLVAATH----VAYPLLQGWVLYVSLT 67

  Fly   112 AYTAAAFFGLTAFCINGLEAYGNYRR 137
            ::..:..|.::..       :|.|:|
Mouse    68 SFLISLMFLMSYL-------FGFYKR 86

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12730NP_572228.1 None
MallNP_663507.1 MARVEL 25..149 CDD:366555 18/91 (20%)

Return to query results.
Submit another query.