DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12730 and Mall

DIOPT Version :9

Sequence 1:NP_001284896.1 Gene:CG12730 / 31466 FlyBaseID:FBgn0029771 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_663507.1 Gene:Mall / 228576 MGIID:2385152 Length:154 Species:Mus musculus


Alignment Length:91 Identity:18/91 - (19%)
Similarity:33/91 - (36%) Gaps:37/91 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 SFYLAVVTIGFVATGCLLLARYLRLWQRQFCRCDPTLWSL--AVHSSLALAYFTASGLVLSLDIG 111
            :|:|..:..||              |          :|:|  |.|    :||....|.||.:.:.
Mouse    31 AFFLPELVFGF--------------W----------VWTLVAATH----VAYPLLQGWVLYVSLT 67

  Fly   112 AYTAAAFFGLTAFCINGLEAYGNYRR 137
            ::..:..|.::..       :|.|:|
Mouse    68 SFLISLMFLMSYL-------FGFYKR 86

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12730NP_001284896.1 None
MallNP_663507.1 MARVEL 25..149 CDD:366555 18/91 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22776
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.