powered by:
Protein Alignment CG12730 and C42D8.1
DIOPT Version :9
Sequence 1: | NP_001284896.1 |
Gene: | CG12730 / 31466 |
FlyBaseID: | FBgn0029771 |
Length: | 148 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_508869.2 |
Gene: | C42D8.1 / 180782 |
WormBaseID: | WBGene00016599 |
Length: | 252 |
Species: | Caenorhabditis elegans |
Alignment Length: | 68 |
Identity: | 16/68 - (23%) |
Similarity: | 23/68 - (33%) |
Gaps: | 26/68 - (38%) |
- Green bases have known domain annotations that are detailed below.
Fly 81 CDPTLWSLAVHSSLALAYF--------------TASG--LVLSLDIGAYTA-------AAFFGLT 122
|.|.:|. |....|.:| |..| ..:.:::..||| ..|.||:
Worm 56 CTPHMWG---HPMGLLRWFQLLMFFVLQWLVQITCGGDACTMIMNVFGYTAMGQLFVLVIFLGLS 117
Fly 123 AFC 125
.||
Worm 118 MFC 120
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG12730 | NP_001284896.1 |
None |
C42D8.1 | NP_508869.2 |
MARVEL |
61..207 |
CDD:279608 |
14/63 (22%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR22776 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.100 |
|
Return to query results.
Submit another query.