DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12730 and C42D8.1

DIOPT Version :9

Sequence 1:NP_001284896.1 Gene:CG12730 / 31466 FlyBaseID:FBgn0029771 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_508869.2 Gene:C42D8.1 / 180782 WormBaseID:WBGene00016599 Length:252 Species:Caenorhabditis elegans


Alignment Length:68 Identity:16/68 - (23%)
Similarity:23/68 - (33%) Gaps:26/68 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 CDPTLWSLAVHSSLALAYF--------------TASG--LVLSLDIGAYTA-------AAFFGLT 122
            |.|.:|.   |....|.:|              |..|  ..:.:::..|||       ..|.||:
 Worm    56 CTPHMWG---HPMGLLRWFQLLMFFVLQWLVQITCGGDACTMIMNVFGYTAMGQLFVLVIFLGLS 117

  Fly   123 AFC 125
            .||
 Worm   118 MFC 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12730NP_001284896.1 None
C42D8.1NP_508869.2 MARVEL 61..207 CDD:279608 14/63 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22776
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.