DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12730 and CMTM8

DIOPT Version :9

Sequence 1:NP_001284896.1 Gene:CG12730 / 31466 FlyBaseID:FBgn0029771 Length:148 Species:Drosophila melanogaster
Sequence 2:XP_011531718.1 Gene:CMTM8 / 152189 HGNCID:19179 Length:196 Species:Homo sapiens


Alignment Length:172 Identity:37/172 - (21%)
Similarity:67/172 - (38%) Gaps:45/172 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 YDRKYLLSMPGLCKLACLLCSF--------------------VGIL--CIICGP--VRVSNFRGS 49
            |||::|.::||...:|.:|.|.                    :|:|  .:|.|.  .||..|...
Human    32 YDREFLRTLPGFLIVAEILISLPITDPLHRSALSTTARDILVLGLLVWTLIAGTEYFRVPAFGWV 96

  Fly    50 FYLA----VVTIGFVATGCLLLARYLRLWQRQFCRCDPTLWSLAVHSSLALAYFTASGLVLSL-- 108
            .::|    |:|:.|       |..|:.:...:..:...|...|..:.|..:.|.:|:.:..|.  
Human    97 MFVAVFYWVLTVFF-------LIIYITMTYTRIPQVPWTTVGLCFNGSAFVLYLSAAVVDASSVS 154

  Fly   109 ------DIGAYTAAAFFG-LTAFCINGLEAYGNYRRSRQREV 143
                  :..::.|::||. |...|..| ..|.::...|.|.:
Human   155 PERDSHNFNSWAASSFFAFLVTICYAG-NTYFSFIAWRSRTI 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12730NP_001284896.1 None
CMTM8XP_011531718.1 MARVEL 72..185 CDD:279608 25/120 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4788
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22776
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.