DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG12730 and CMTM3

DIOPT Version :9

Sequence 1:	NP_001284896.1	Gene:	CG12730 / 31466	FlyBaseID:	FBgn0029771	Length:	148	Species:	Drosophila melanogaster
Sequence 2:	NP_001350847.1	Gene:	CMTM3 / 123920	HGNCID:	19174	Length:	182	Species:	Homo sapiens

Alignment Length:	132	Identity:	33/132 - (25%)
Similarity:	47/132 - (35%)	Gaps:	27/132 - (20%)

- Green bases have known domain annotations that are detailed below.

  Fly    11 RKYLLSMPGLCKLACLLCSFVGILCIICGPVRVSNFRGSFYLAVVTIGFVATGCLLLARYLRL-- 73
            |.:|.|:.|...||....||:..:|.:..       ..|.:|....:.|:.....|.|..::|
Human    34 RAFLCSLKGRLLLAESGLSFITFICYVAS-------SASAFLTAPLLEFLLALYFLFADAMQLND 91

  Fly    74 -WQ------RQFCRCDPTLWSLAVHSSLALAYFTAS-GLVLSLDIGAYTAAAFFGLTAFCINGLE 130
             ||      ..|.||          .:.||.||..| ..:.....||..||..||..|..:...:
Human    92 KWQGLCWPMMDFLRC----------VTAALIYFAISITAIAKYSDGASKAAGVFGFFATIVFATD 146

  Fly   131 AY 132
            .|
Human   147 FY 148

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG12730	NP_001284896.1	None
CMTM3	NP_001350847.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..21
CMTM3	NP_001350847.1	MARVEL	36..149	CDD:307448	32/130 (25%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG4788
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	1	1.100	-	-	O	PTHR22776
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	2	2.000