powered by:
Protein Alignment CG12730 and CMTM5
DIOPT Version :9
Sequence 1: | NP_001284896.1 |
Gene: | CG12730 / 31466 |
FlyBaseID: | FBgn0029771 |
Length: | 148 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001275675.1 |
Gene: | CMTM5 / 116173 |
HGNCID: | 19176 |
Length: | 223 |
Species: | Homo sapiens |
Alignment Length: | 62 |
Identity: | 16/62 - (25%) |
Similarity: | 24/62 - (38%) |
Gaps: | 10/62 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 85 LWSLAVHS----------SLALAYFTASGLVLSLDIGAYTAAAFFGLTAFCINGLEAYGNYR 136
||.:..|| |..:.:...|...::...||..||..||:....|...:|:..||
Human 149 LWFICFHSLGSSDFLRCVSAIIIFLVVSFAAVTSRDGAAIAAFVFGIILVSIFAYDAFKIYR 210
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG12730 | NP_001284896.1 |
None |
CMTM5 | NP_001275675.1 |
MARVEL |
29..152 |
CDD:279608 |
2/2 (100%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4788 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR22776 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
2 | 2.000 |
|
Return to query results.
Submit another query.