powered by:
Protein Alignment CG12730 and CMTM1
DIOPT Version :9
Sequence 1: | NP_001284896.1 |
Gene: | CG12730 / 31466 |
FlyBaseID: | FBgn0029771 |
Length: | 148 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_443725.3 |
Gene: | CMTM1 / 113540 |
HGNCID: | 19172 |
Length: | 286 |
Species: | Homo sapiens |
Alignment Length: | 37 |
Identity: | 11/37 - (29%) |
Similarity: | 20/37 - (54%) |
Gaps: | 7/37 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MSLTGTQDYDRKYLLSMPG-LCKLACLLCSFVGILCI 36
:::...|:..|::||.:.| ||..|.::| ||
Human 212 VAILAMQEKKRRHLLYVGGSLCLTAVIVC------CI 242
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG12730 | NP_001284896.1 |
None |
CMTM1 | NP_443725.3 |
MARVEL |
131..>216 |
CDD:296526 |
0/3 (0%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4788 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR22776 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
2 | 2.000 |
|
Return to query results.
Submit another query.