DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12730 and CMTM7

DIOPT Version :9

Sequence 1:NP_001284896.1 Gene:CG12730 / 31466 FlyBaseID:FBgn0029771 Length:148 Species:Drosophila melanogaster
Sequence 2:XP_016861135.1 Gene:CMTM7 / 112616 HGNCID:19178 Length:179 Species:Homo sapiens


Alignment Length:144 Identity:37/144 - (25%)
Similarity:54/144 - (37%) Gaps:34/144 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 DRKYLLSMPGLCKLACLLCSFVGILCIICGPVRVS---NFRGSFYLAVVTIGFVATGC---LLLA 68
            |..|..:...|.|:|.::...:..:|     ||.|   |:....|..||||      |   ::||
Human    37 DLSYPRTHAALLKVAQMVTLLIAFIC-----VRSSLWTNYSAYSYFEVVTI------CDLIMILA 90

  Fly    69 RYL----RLWQRQFCRCDP----------TLWSLAVHSSLALAYFTASGLV---LSLDIGAYTAA 116
            .||    |.::...|...|          ||..|......|...:..||||   :.:..||:...
Human    91 FYLVHLFRFYRVLTCISWPLSELLHYLIGTLLLLIASIVAASKSYNQSGLVAGAVRMFWGAFRNE 155

  Fly   117 AFFGLTAFCINGLE 130
            ..|.:..|.:.|.|
Human   156 FLFKMLIFFLMGEE 169



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4788
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1520058at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22776
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.