DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12730 and LOC102554842

DIOPT Version :9

Sequence 1:NP_001284896.1 Gene:CG12730 / 31466 FlyBaseID:FBgn0029771 Length:148 Species:Drosophila melanogaster
Sequence 2:XP_008770480.1 Gene:LOC102554842 / 102554842 RGDID:7687446 Length:185 Species:Rattus norvegicus


Alignment Length:146 Identity:31/146 - (21%)
Similarity:49/146 - (33%) Gaps:49/146 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 QDYDRKYLLSMPGLCKLACLLCSFVGILCIICGPVRVSNFRGSFYLAVVTIGFVATGCLLLARYL 71
            :|.::.:.....|..|..||:.....::|.    .||:..      .|:|        |||...|
  Rat    18 KDSNKDFWTQGHGTTKSFCLILITTALICF----QRVATH------PVLT--------LLLTMEL 64

  Fly    72 RLWQRQFCRCDPTLWSLAVH--------------SSLALAYFTASGLVLS------LDIGAYTA- 115
            .::...|     .|:|.|||              :.|....|...|:..:      |.:...|| 
  Rat    65 SIFAFFF-----FLYSFAVHRYIPFIFWPMMDLMNDLFATIFLLGGIAFANEARRELPMPYMTAM 124

  Fly   116 -----AAFFGLTAFCI 126
                 ||||.:...|:
  Rat   125 ILMGVAAFFAIIDLCL 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12730NP_001284896.1 None
LOC102554842XP_008770480.1 MARVEL 24..140 CDD:279608 29/138 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22776
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.