DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12730 and LOC101882206

DIOPT Version :9

Sequence 1:NP_001284896.1 Gene:CG12730 / 31466 FlyBaseID:FBgn0029771 Length:148 Species:Drosophila melanogaster
Sequence 2:XP_005174257.1 Gene:LOC101882206 / 101882206 -ID:- Length:288 Species:Danio rerio


Alignment Length:163 Identity:31/163 - (19%)
Similarity:56/163 - (34%) Gaps:56/163 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 YLLSMPGLCKL-----AC-LLCSFVG-------ILCIICGPV---------------RVSNFRGS 49
            |:.::||..|:     || :|.|.:|       |.||:...|               ::.|.. .
Zfish   145 YVAALPGFLKILEAFVACVILISLIGYTGKPALIWCIVAYVVPLPLTLLVIITNILTKIKNCL-P 208

  Fly    50 FYLAVVTIGFVATGCLLLARYLRLW---------QRQFCRCDPTLWSLAVHSSLALAYFTASGLV 105
            |.:..:|:.|:....||......||         :.:.|..:..:||:    ...:.:.|     
Zfish   209 FSIDRLTMLFLIISVLLYISAAILWPIYSFRGNPRPKDCPGNSCVWSI----QFVVTFMT----- 264

  Fly   106 LSLDIGAYTAAAFFGLTAFCINGLEAYGNYRRS 138
             .:::|.|.....|.....|        .::||
Zfish   265 -YVNLGLYVIDLVFTCLGIC--------GFKRS 288



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4788
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.