DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12730 and LOC100912321

DIOPT Version :9

Sequence 1:NP_001284896.1 Gene:CG12730 / 31466 FlyBaseID:FBgn0029771 Length:148 Species:Drosophila melanogaster
Sequence 2:XP_008769458.1 Gene:LOC100912321 / 100912321 RGDID:6487726 Length:316 Species:Rattus norvegicus


Alignment Length:164 Identity:31/164 - (18%)
Similarity:48/164 - (29%) Gaps:83/164 - (50%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 YLLSMPGLCK-----LACLL------------------CSFVGILCIICGPVRVSNFRGSFYL-A 53
            |:.|..|:.|     :||::                  |..|.|:|.|...|.:..:.|.... .
  Rat   169 YMASKTGMLKVFESFVACIIFLFLNNPHLYTQEPVLQWCLSVYIICFILTMVVILLYLGKCTKNL 233

  Fly    54 VVTIGFVATG----CLLL---------------------------------ARYLRLWQRQFCRC 81
            ::.:....||    |:||                                 |..:.:|.||    
  Rat   234 LIPLSTFLTGMTFLCVLLYTTAIVLWPLYKFSEGFHGVPNRVMDSSCNYKHAHSVCVWDRQ---- 294

  Fly    82 DPTLWSLAVHSSLALAYFTASGLVLSLDIGAYTA 115
                        :|:|:.|...||      ||||
  Rat   295 ------------VAVAFLTGVNLV------AYTA 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12730NP_001284896.1 None
LOC100912321XP_008769458.1 MARVEL 169..312 CDD:366555 31/164 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4788
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.