DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12730 and CKLF-CMTM1

DIOPT Version :10

Sequence 1:NP_572228.1 Gene:CG12730 / 31466 FlyBaseID:FBgn0029771 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_001191028.1 Gene:CKLF-CMTM1 / 100529251 HGNCID:39977 Length:168 Species:Homo sapiens


Alignment Length:37 Identity:11/37 - (29%)
Similarity:20/37 - (54%) Gaps:7/37 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSLTGTQDYDRKYLLSMPG-LCKLACLLCSFVGILCI 36
            :::...|:..|::||.:.| ||..|.::|      ||
Human    94 VAILAMQEKKRRHLLYVGGSLCLTAVIVC------CI 124

Return to query results.
Submit another query.