DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment frma and F41C6.4

DIOPT Version :9

Sequence 1:NP_572226.2 Gene:frma / 31464 FlyBaseID:FBgn0029769 Length:611 Species:Drosophila melanogaster
Sequence 2:NP_001129930.1 Gene:F41C6.4 / 185599 WormBaseID:WBGene00018278 Length:393 Species:Caenorhabditis elegans


Alignment Length:497 Identity:85/497 - (17%)
Similarity:146/497 - (29%) Gaps:223/497 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 ADPCQNFYKVAC--GNWSASHATDSYESFMDRLDYNYQEKLADLLDNEREDDEPHFLQQLRNFYT 87
            :|||.:||:.||  |                  ||:                   ||..::  |.
 Worm    33 SDPCDDFYRHACPVG------------------DYD-------------------FLVLMK--YA 58

  Fly    88 ACRKPLSQDQVLRILEHLIVME---NIQNEELSVGLTAAFRLQVLIDLNDSNTYDIWKQLMSHRK 149
            ...|.|...|.....|:|.:.|   ||:..|:...::|.|. :|.:|:..:|             
 Worm    59 PIFKELETSQEESAWENLKIEEALNNIKPGEIENEISAYFE-RVFLDMCQNN------------- 109

  Fly   150 HWDPNTT-----NREPLTREMFDKLWA-----------SLPKIPFPFK---------EYYWRELS 189
              ||..|     .::.|:.||..|..|           :..:....||         .:|...:.
 Worm   110 --DPAMTTFLLRTQQMLSHEMSTKCRAENCLLRLGGDSNCTRAANDFKSRVAKKTDSSHYQEYVL 172

  Fly   190 ELEEKIMSYGSE--------DDGFDSGDLVTRIPPFWMMPWPNGNITYENLSQMAHWLDIKANEF 246
            :|.|.|..:.::        |..|..|  |..|..|.|          ..:..:..|:.:     
 Worm   173 KLRENIAGWKNKTRAVNILLDGNFKVG--VDNINSFLM----------NMVDVLLQWIQV----- 220

  Fly   247 ILTYIYMRLKLVAEGVSTESWHIDRDQCAEQSRQILSHPAAWLVEKNHPRLKEEPVLQDIFAELK 311
               |.|:                     |:...:::.....|:.::...|.. |.|.:|:|  :.
 Worm   221 ---YKYI---------------------AKNPFELILQETPWVNDQKINRAL-EAVARDLF--VI 258

  Fly   312 QRFGQKLLANRNNFTRSTQHFLLGKLKRMRLRLSILPRNSSAQSMVRRIERHYRDVHMNASDYFG 376
            ..:|.:|..|.:...::.|.||                                   ..::|:.|
 Worm   259 DEYGIQLRENIDALMKTEQDFL-----------------------------------KCSADFSG 288

  Fly   377 NLHIGLNHSRSHKKYAQLWAIVF---GRQLIPSRISKSDLYPTQVRGYGTYASAFYIVKQNMLIV 438
                      .|..:..:::..|   ||             .|.|..:|..|:..:         
 Worm   289 ----------KHDLFCSIYSYHFMFNGR-------------TTTVLHFGYDATNRH--------- 321

  Fly   439 PLSLLEPPFYTHGQPSI---------LTYSALGFILGHELSH 471
                   |:...|.|.|         ......|:::||||||
 Worm   322 -------PYIYFGMPFIARAANSEMAANLGLAGYVVGHELSH 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
frmaNP_572226.2 GluZincin 25..601 CDD:301352 85/497 (17%)
F41C6.4NP_001129930.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11733
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.