DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment frma and nep-4

DIOPT Version :9

Sequence 1:NP_572226.2 Gene:frma / 31464 FlyBaseID:FBgn0029769 Length:611 Species:Drosophila melanogaster
Sequence 2:NP_509156.2 Gene:nep-4 / 183746 WormBaseID:WBGene00016896 Length:437 Species:Caenorhabditis elegans


Alignment Length:197 Identity:52/197 - (26%)
Similarity:81/197 - (41%) Gaps:48/197 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   445 PPFY--THG--QPSILTYSALGFILGHELSHGFDSEGMTFSSHGVGSSAVDRELDRNPRFQQEL- 504
            |.:|  |:|  :.|.|.|:  |..:|||:.|       ||..|.:..       |..|.|.:.. 
 Worm   250 PNYYHTTYGNWRASKLGYT--GTRVGHEIGH-------TFIEHSINP-------DGLPYFSKPAE 298

  Fly   505 GCLRRRFGRKRYEKF-------------------ADASGLELAYSAYFDTAQTDHKRNRSAEELV 550
            .|::.::.:...|.:                   ||..||:||| |..:...:|..|.::....:
 Worm   299 DCVQNQYLKTCNEYYEGEVPDACNTSDYTFDDNGADVFGLQLAY-AILERDLSDQLREQADGLKI 362

  Fly   551 TQKQQFFHNFAQFFC-SDKELLQAHDHGSDRKRVNDAVAHFEPFREAFSCGPSPR-----RRQCR 609
            |.:|..|::||..|| ..|.......|.....|:| |||....|::||:|....|     .:||.
 Worm   363 TNEQLLFYSFAYRFCRGSKSNTTDGSHSHHNVRIN-AVAQMPGFQQAFNCASDSRMMKSATKQCV 426

  Fly   610 LY 611
            :|
 Worm   427 IY 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
frmaNP_572226.2 GluZincin 25..601 CDD:301352 48/180 (27%)
nep-4NP_509156.2 GluZincin 250..425 CDD:387391 49/192 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11733
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.