DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment frma and kel

DIOPT Version :9

Sequence 1:NP_572226.2 Gene:frma / 31464 FlyBaseID:FBgn0029769 Length:611 Species:Drosophila melanogaster
Sequence 2:XP_005157998.1 Gene:kel / 101882278 ZFINID:ZDB-GENE-110411-118 Length:759 Species:Danio rerio


Alignment Length:611 Identity:120/611 - (19%)
Similarity:199/611 - (32%) Gaps:211/611 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 DEPHF----------------LQQLRNFYTACRKPLSQDQVLRILEHLIVM-----ENIQNEELS 117
            |||||                .:.||.||:||.            ::|:::     ...|:..|.
Zfish   270 DEPHFQFPIEWNSKTQKAKANTRYLRPFYSACG------------QYLVLLGVPSDRTTQHCGLF 322

  Fly   118 VGLT-----AAFRLQVLIDLNDSNTYDIWKQLMSHRKHWDPNTTNREPLT-----------REMF 166
            |.|:     |.|.|          .|.:.::|:..|      ||.:|..|           :..|
Zfish   323 VSLSTTLAVATFPL----------PYRLSQKLLYRR------TTIQELQTLAPAVDWLACLQATF 371

  Fly   167 DKLWAS---------LPKIPFPFKEYYWRELSELEEKIMSYGSEDDGFDSGDLVTRIPP-----F 217
            ..|..|         ||.|....|..:   |.:::.::|..|..:.......|.|.||.     |
Zfish   372 QPLLISKSDIVLVHNLPYIIHMSKTIH---LWQVQHELMGTGPLNTYMIFSLLQTLIPALDSRFF 433

  Fly   218 WMMPWPNGNITYENLSQMAHWLDIKANEFILTYIYMRLKLVAEGVSTESWHIDRDQCAEQSRQ-- 280
            .:|  .|.:|...:..:|.||                            |     :|.:|:.:  
Zfish   434 QIM--RNYSIATGDTQEMPHW----------------------------W-----RCVQQTERGF 463

  Fly   281 --ILSHPAAWLVEKNHPRLKEEPVLQDIFAELKQRFGQKLLANRNNFTRSTQHFLLGKLKRMRLR 343
              :|||    .:.:.|.:.:.|.::||:::.||     |.|.:.:........|:|.|:..:..|
Zfish   464 DTLLSH----AIREKHAQKEAEELIQDVYSSLK-----KKLTDLSWRDEKESDFILNKINSLNPR 519

  Fly   344 LSILPRNSSAQSMVRRIERHYRDVHMNASDYFGN-LHIGLNHSRSHKKYAQLWAIVFGRQLIPSR 407
            :|....|.|    ...:...|..|.:|..|:|.| |.|.|...:|..:...|.....|..:.|  
Zfish   520 ISTNTNNLS----YTELNHLYEKVILNEEDFFSNYLQILLLEQKSRARLLSLGTQTEGLSMTP-- 578

  Fly   408 ISKSDLYPTQVRGYGTYASAFYIVKQNMLIVPLSLLEPPFYTHGQPSILTYSALGFILGHELSH- 471
                                  .:..|.:|||:.:...||:....|..|.|..||.::..:|.| 
Zfish   579 ----------------------FISGNDIIVPVGMFVSPFFHSSYPRALNYGTLGSLMAKDLLHL 621

  Fly   472 ----------GFDSEGMTFSSHGVGSSAVDRELDRNPRFQQELGCLRRRFGRKRYEKFADASGLE 526
                      ..::|.:...||.:       .:.:.|.:    |........|:.|.:...|.|:
Zfish   622 LLPDIYTKAKNPETESLCVWSHYL-------SVTKGPGW----GDAFYLPSSKQQEVWVQYSALQ 675

  Fly   527 LAYSAYFDTAQTDHKRNRSAEEL--VTQKQQFFHNFAQFFCSDKELLQAHDHGSDRKRVNDAVAH 589
            :|..||    :...||..:...|  .:....|..:|.:..|.                 .||...
Zfish   676 VALDAY----KMSFKRYLADSSLPGFSYVHLFLSSFTKVTCD-----------------TDAYRE 719

  Fly   590 FEPFREAF-------SCGPSPRRRQC 608
            |.|...:|       :.|..|:...|
Zfish   720 FMPLEPSFLVTVLCSNSGLCPKPLTC 745

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
frmaNP_572226.2 GluZincin 25..601 CDD:301352 117/602 (19%)
kelXP_005157998.1 GluZincin 99..>620 CDD:301352 93/452 (21%)
GluZincin 583..>721 CDD:301352 33/169 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11733
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.