| Sequence 1: | NP_001368972.1 | Gene: | SPR / 31463 | FlyBaseID: | FBgn0029768 | Length: | 512 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001122861.1 | Gene: | C25F9.13 / 6418701 | WormBaseID: | WBGene00045413 | Length: | 224 | Species: | Caenorhabditis elegans |
| Alignment Length: | 200 | Identity: | 45/200 - (22%) |
|---|---|---|---|
| Similarity: | 82/200 - (41%) | Gaps: | 19/200 - (9%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 98 FLLIITIISNSL-IVLVLSKKSMATPTNFVLMGMAICDMLTVIFPAP-GLWYMYTFGNHYKPLHP 160
Fly 161 VSMCLAYSIFNEIMPA---MCHTISVWLTLALAVQRYIYVCHAPMARTWCTMPRVRRCTAYIALL 222
Fly 223 AFLHQLPRFFDRTYMPLVIEWNGSPTEVCHLETSMWVHDYIGVDLYYTSYYLFRVLFVHLLPCII 287
Fly 288 LVTLN 292 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| SPR | NP_001368972.1 | 7tmA_FMRFamide_R-like | 90..400 | CDD:410630 | 44/199 (22%) |
| TM helix 1 | 92..116 | CDD:410630 | 3/18 (17%) | ||
| TM helix 2 | 124..146 | CDD:410630 | 10/22 (45%) | ||
| TM helix 3 | 169..191 | CDD:410630 | 5/24 (21%) | ||
| TM helix 4 | 214..230 | CDD:410630 | 4/15 (27%) | ||
| TM helix 5 | 270..293 | CDD:410630 | 6/22 (27%) | ||
| TM helix 6 | 328..353 | CDD:410630 | |||
| TM helix 7 | 368..393 | CDD:410630 | |||
| C25F9.13 | NP_001122861.1 | 7tm_GPCRs | 21..>210 | CDD:391938 | 44/198 (22%) |
| TM helix 2 | 51..83 | CDD:341315 | 11/31 (35%) | ||
| TM helix 3 | 101..128 | CDD:341315 | 7/26 (27%) | ||
| TM helix 4 | 140..160 | CDD:341315 | 4/19 (21%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 0 | 0.000 | |||||