DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SPR and P2RY10

DIOPT Version :9

Sequence 1:NP_001368972.1 Gene:SPR / 31463 FlyBaseID:FBgn0029768 Length:512 Species:Drosophila melanogaster
Sequence 2:NP_001311154.1 Gene:P2RY10 / 27334 HGNCID:19906 Length:364 Species:Homo sapiens


Alignment Length:392 Identity:76/392 - (19%)
Similarity:151/392 - (38%) Gaps:110/392 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 RMEDNNISYWNLTCD-SPLEYAMPLYGYCMPFLLIITIISNSLIVLVL----SKKSMATPTNFVL 127
            :|..|:.|...:.|: :.:::...||......:.|..:::||..:.||    |||:.|.   ..:
Human    37 KMGSNSTSTAEIYCNVTNVKFQYSLYATTYILIFIPGLLANSAALWVLCRFISKKNKAI---IFM 98

  Fly   128 MGMAICDMLTVIFPAPGLWYMYTFGNHYKPLHPVSMCLA--YSIFNEIMPAMCHTISVWLTLALA 190
            :.:::.|:..|:.....::|   :.:|:.|... ::||.  |..:..:..::|     :|| .::
Human    99 INLSVADLAHVLSLPLRIYY---YISHHWPFQR-ALCLLCFYLKYLNMYASIC-----FLT-CIS 153

  Fly   191 VQRYIYVCHAPMARTWCTMPRVRR----CTAYIALLAFLHQLPRFFDRTYMPLVIEWNGSPTEVC 251
            :||..::.....||.|     .||    .:|.|.::.....||       .|::...:.:..:.|
Human   154 LQRCFFLLKPFRARDW-----KRRYDVGISAAIWIVVGTACLP-------FPILRSTDLNNNKSC 206

  Fly   252 HLETSMWVHDYIGVDLYY---TSYYLFRVLFV-----HLLPCIILVTLNILLFAAMRQ------- 301
            .            .||.|   .:..|..::.|     .::|.||:.........::||       
Human   207 F------------ADLGYKQMNAVALVGMITVAELAGFVIPVIIIAWCTWKTTISLRQPPMAFQG 259

  Fly   302 AQERRKLLFRENRKKECKKLRETNCTTLMLIVVVSVFLLAEIPIAV------VTAMHIVSSL-II 359
            ..||:|.|                   .|:.:..:||.:...|..:      :....|:||. ::
Human   260 ISERQKAL-------------------RMVFMCAAVFFICFTPYHINFIFYTMVKETIISSCPVV 305

  Fly   360 EFLDY------GLANICIMLTNFFLVFSYPINFGIYCGMSRQFRETF----KEIFLGRLMAKKDS 414
            ....|      .||::|.:|.        ||   :|..|:.:||:..    ..:...|||:|:..
Human   306 RIALYFHPFCLCLASLCCLLD--------PI---LYYFMASEFRDQLSRHGSSVTRSRLMSKESG 359

  Fly   415 ST 416
            |:
Human   360 SS 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SPRNP_001368972.1 7tmA_FMRFamide_R-like 90..400 CDD:410630 67/347 (19%)
TM helix 1 92..116 CDD:410630 6/27 (22%)
TM helix 2 124..146 CDD:410630 2/21 (10%)
TM helix 3 169..191 CDD:410630 3/21 (14%)
TM helix 4 214..230 CDD:410630 4/19 (21%)
TM helix 5 270..293 CDD:410630 5/27 (19%)
TM helix 6 328..353 CDD:410630 4/30 (13%)
TM helix 7 368..393 CDD:410630 5/24 (21%)
P2RY10NP_001311154.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.