DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SPR and Vmn1r-ps103

DIOPT Version :9

Sequence 1:NP_001368972.1 Gene:SPR / 31463 FlyBaseID:FBgn0029768 Length:512 Species:Drosophila melanogaster
Sequence 2:NP_598972.2 Gene:Vmn1r-ps103 / 171245 MGIID:2159658 Length:323 Species:Mus musculus


Alignment Length:182 Identity:38/182 - (20%)
Similarity:59/182 - (32%) Gaps:76/182 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 ISYWNLTCDSPLEYAMPLYGYCMPFLLIITIISNSLIVLVLSK---KSMAT--PTNF-------- 125
            :|:|.    ||.:         .|..||:..::.:.|:|:|:|   |::.|  ..||        
Mouse    75 LSWWG----SPEK---------KPIHLILIHLAFTNIILLLTKGLPKAIETFGIRNFLDDIGCKI 126

  Fly   126 ------VLMGMAIC--DMLTV-----IFPAPGLWYMYTFGNHYKPLHP----------------- 160
                  |..|:::|  .:|||     |.|....|         :.|.|                 
Mouse   127 IVYLGRVARGLSLCTSSLLTVVQAIIISPRASGW---------RRLRPKSAQHILPFLLFFWILN 182

  Fly   161 --VSMCLAYSIFNEIMPAMCHTISVWLTLALAVQRYIYVCHAPMARTWCTMP 210
              :||.|.:||.:..|....|..|         ..|.|.........|..:|
Mouse   183 GLISMNLIHSIISTGMNISQHKNS---------DNYCYFMQESQEIKWIVLP 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SPRNP_001368972.1 7tmA_FMRFamide_R-like 90..400 CDD:410630 34/166 (20%)
TM helix 1 92..116 CDD:410630 6/23 (26%)
TM helix 2 124..146 CDD:410630 10/42 (24%)
TM helix 3 169..191 CDD:410630 4/21 (19%)
TM helix 4 214..230 CDD:410630
TM helix 5 270..293 CDD:410630
TM helix 6 328..353 CDD:410630
TM helix 7 368..393 CDD:410630
Vmn1r-ps103NP_598972.2 V1R 79..298 CDD:112227 36/178 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D421120at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.