DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15784 and CRTAC1

DIOPT Version :9

Sequence 1:NP_001284891.1 Gene:CG15784 / 31461 FlyBaseID:FBgn0029766 Length:554 Species:Drosophila melanogaster
Sequence 2:XP_016871855.1 Gene:CRTAC1 / 55118 HGNCID:14882 Length:663 Species:Homo sapiens


Alignment Length:138 Identity:36/138 - (26%)
Similarity:47/138 - (34%) Gaps:62/138 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly   200 HKHGHG-------------PHHHGR----------------HGHHGRPHHHH----PHGH-HFGP 230
            |..|.|             ||.|||                :|:...||..:    .||. .|..
Human   269 HNRGDGTFVDAAASAGVDDPHQHGRGVALADFNRDGKVDIVYGNWNGPHRLYLQMSTHGKVRFRD 333

  Fly   231 HFGPHFGPHAGPSPF------DFDRRSFRGPWHDQSQ--FFQWMGLPWALDNAAANRRSHSLPRL 287
            ...|.|   :.|||.      |||        :||..  ||..:    |..:::|||    |.|:
Human   334 IASPKF---SMPSPVRTVITADFD--------NDQELEIFFNNI----AYRSSSANR----LFRV 379

  Fly   288 SRRDCRGD 295
            .||: .||
Human   380 IRRE-HGD 386



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28HUS
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.