DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15784 and ZCCHC10

DIOPT Version :9

Sequence 1:NP_001284891.1 Gene:CG15784 / 31461 FlyBaseID:FBgn0029766 Length:554 Species:Drosophila melanogaster
Sequence 2:NP_001295056.1 Gene:ZCCHC10 / 54819 HGNCID:25954 Length:202 Species:Homo sapiens


Alignment Length:112 Identity:37/112 - (33%)
Similarity:53/112 - (47%) Gaps:13/112 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 PASSKRYTKALKKVTKVQRMLEQAMILLAEEEARCRQQEQEQGTKRTKKQLKKKAKKDKKKAKKL 111
            |:.:....||||:  |..|:|.|..|           .|.....|..||:.|.........:...
Human    78 PSRTAELKKALKE--KENRLLLQQSI-----------GETNVERKAKKKRSKSVTSSSSSSSDSS 129

  Fly   112 AKQQAKKQAEEQTAAGEEPSNTSSSSSSSSSSSSSSSSSSSSSSEDE 158
            |...:.:..|..|::..|.|:|..||||||||:||::|||||.|:.:
Human   130 ASDSSSESEETSTSSSSEDSDTDESSSSSSSSASSTTSSSSSDSDSD 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15784NP_001284891.1 None
ZCCHC10NP_001295056.1 zf-CCHC_3 49..88 CDD:290628 2/9 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13491
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.