DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG15784 and Crtac1

DIOPT Version :9

Sequence 1:	NP_001284891.1	Gene:	CG15784 / 31461	FlyBaseID:	FBgn0029766	Length:	554	Species:	Drosophila melanogaster
Sequence 2:	NP_599228.2	Gene:	Crtac1 / 171438	RGDID:	621085	Length:	646	Species:	Rattus norvegicus

Alignment Length:	138	Identity:	36/138 - (26%)
Similarity:	48/138 - (34%)	Gaps:	62/138 - (44%)

- Green bases have known domain annotations that are detailed below.

  Fly   200 HKHGHG-------------PHHHGR----------------HGHHGRPHHHH----PHGH-HFGP 230
            |..|:|             ||.|||                :|:...||..:    .||. .|..
  Rat   270 HNQGNGTFVDAAASAGVDDPHQHGRGVALADFNRDGKVDIVYGNWNGPHRLYLQMSAHGKVRFRD 334

  Fly   231 HFGPHFGPHAGPSPF------DFDRRSFRGPWHDQ--SQFFQWMGLPWALDNAAANRRSHSLPRL 287
            ...|.|   :.|||.      |||        :||  ..||..:    |..:::|||    |.|:
  Rat   335 IASPKF---STPSPVRTVIAADFD--------NDQELEVFFNNI----AYRSSSANR----LFRV 380

  Fly   288 SRRDCRGD 295
            .||: .||
  Rat   381 IRRE-HGD 387

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG15784	NP_001284891.1	None
Crtac1	NP_599228.2	VCBS	63..133	CDD:290251
		VCBS	256..310	CDD:290251	8/39 (21%)
		VCBS	300..364	CDD:290251	16/74 (22%)
		UnbV_ASPIC	461..513	CDD:284917
		EGF_CA	560..606	CDD:284955
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_28HUS
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900